Seriola dumerili (greater amberjack): 111221377 Help Entry 111221377         CDS       T05606                                  Symbol ins Name (RefSeq) insulin   KO K04526   insulin Organism sdu  Seriola dumerili (greater amberjack) Pathway sdu04010   MAPK signaling pathway sdu04068   FoxO signaling pathway sdu04081   Hormone signaling sdu04114   Oocyte meiosis sdu04140   Autophagy - animal sdu04150   mTOR signaling pathway sdu04810   Regulation of actin cytoskeleton sdu04910   Insulin signaling pathway sdu04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:sdu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111221377 (ins)    04068 FoxO signaling pathway     111221377 (ins)    04150 mTOR signaling pathway     111221377 (ins)   09133 Signaling molecules and interaction    04081 Hormone signaling     111221377 (ins)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111221377 (ins)   09143 Cell growth and death    04114 Oocyte meiosis     111221377 (ins)   09142 Cell motility    04810 Regulation of actin cytoskeleton     111221377 (ins)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     111221377 (ins)    04914 Progesterone-mediated oocyte maturation     111221377 (ins)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sdu04052]     111221377 (ins) Cytokines and neuropeptides [BR:sdu04052]  Neuropeptides   Unclassified    111221377 (ins) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  111221377 NCBI-ProteinID:  XP_022600464 UniProt:  Q18NR0 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MAALWLQSVSLLVLLIVSWPGSQAVAPPQHLCGSHLVDALYLVCGDRGFFYNPKRDVDPL LGFLPPKAGGAAAAGGENEVAEFAFKDQMEMMVKRGIVEQCCHKPCNIFDLQNYCN NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcggcgctgtggctccagtctgtctctctgctggtcttactgatcgtatcgtggccg ggctcccaggccgtcgcccccccgcagcacctttgcggctcgcacctggtcgacgccctg tacctggtctgtggggacagaggcttcttctacaaccccaagagagacgtcgaccctctg ctgggtttcctccctcccaaggcgggtggagctgcggcggcgggcggtgaaaacgaagtg gccgagttcgccttcaaggaccagatggagatgatggtgaagcgaggcatcgtggagcag tgctgccacaagccctgcaacatcttcgacctgcagaactactgcaactga

DBGET integrated database retrieval system