Seriola dumerili (greater amberjack): 111223183 Help Entry 111223183         CDS       T05606                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism sdu  Seriola dumerili (greater amberjack) Pathway sdu04382   Cornified envelope formation sdu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sdu00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     111223183  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111223183  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sdu04147]     111223183 Exosome [BR:sdu04147]  Exosomal proteins   Exosomal proteins of microglial cells    111223183 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EH NNH2 Motif Other DBs NCBI-GeneID:  111223183 NCBI-ProteinID:  XP_022602948 UniProt:  A0A3B4V4K2 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MPSELETAMESLIKVFHRYASKEGRTGTLNRRELRELMENELSNFLKSQKDPAAVDKIMK DLDTNGDGQVDFEEFVSLVVGLSIACEQCYQMHMKKTGKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggaaaccgccatggagtcactcatcaaggtgttccaccgctacgcc tctaaagagggccggaccggcacactcaaccgacgagagctcagagagctgatggagaac gagctgtctaacttcctcaagtctcagaaggaccctgctgctgtcgacaagatcatgaag gacctggacaccaacggtgatggccaggtggactttgaggagtttgtttcgctggttgtc ggactttccattgcctgtgagcagtgctatcagatgcacatgaagaagactggaaagaag taa

DBGET integrated database retrieval system