Seriola dumerili (greater amberjack): 111223363 Help Entry 111223363         CDS       T05606                                  Name (RefSeq) CD59 glycoprotein-like   KO K04008   CD59 antigen Organism sdu  Seriola dumerili (greater amberjack) Brite KEGG Orthology (KO) [BR:sdu00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sdu04147]     111223363    04090 CD molecules [BR:sdu04090]     111223363    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sdu00537]     111223363 Exosome [BR:sdu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111223363   Exosomal proteins of other body fluids (saliva and urine)    111223363   Exosomal proteins of colorectal cancer cells    111223363 CD molecules [BR:sdu04090]  Proteins   111223363 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sdu00537]  Antigens   111223363 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Motif Other DBs NCBI-GeneID:  111223363 NCBI-ProteinID:  XP_022603191 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MRSSVVFCLAVSFAMFGFGVSLQCYSCPDGTSSSCEVKQQCNQGEDSCIKITSGETIYTR CISYADCEFRTLAVRYPIPQFTFSCCQSELCNGQEKSVFQKLKDFFKN NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgaggagctctgtggtgttttgcctggctgtcagctttgccatgtttggatttggcgtc tcgctgcagtgttactcctgccctgatggcacctccagcagctgtgaagtcaagcagcag tgtaaccagggtgaagacagctgcatcaaaatcaccagtggagaaacgatctacaccaga tgcattagctacgcagactgtgagttcaggactctggctgtcagataccccatccctcaa ttcaccttctcctgctgtcagtccgaactctgcaacggccaagaaaaaagtgtttttcag aaattaaaggatttctttaagaattaa

DBGET integrated database retrieval system