Seriola dumerili (greater amberjack): 111226678 Help Entry 111226678         CDS       T05606                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism sdu  Seriola dumerili (greater amberjack) Pathway sdu04010   MAPK signaling pathway sdu04068   FoxO signaling pathway sdu04081   Hormone signaling sdu04114   Oocyte meiosis sdu04140   Autophagy - animal sdu04150   mTOR signaling pathway sdu04810   Regulation of actin cytoskeleton sdu04910   Insulin signaling pathway sdu04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:sdu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111226678    04068 FoxO signaling pathway     111226678    04150 mTOR signaling pathway     111226678   09133 Signaling molecules and interaction    04081 Hormone signaling     111226678  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111226678   09143 Cell growth and death    04114 Oocyte meiosis     111226678   09142 Cell motility    04810 Regulation of actin cytoskeleton     111226678  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     111226678    04914 Progesterone-mediated oocyte maturation     111226678  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sdu04052]     111226678 Cytokines and neuropeptides [BR:sdu04052]  Neuropeptides   Unclassified    111226678 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta CoA_binding_3 Motif Other DBs NCBI-GeneID:  111226678 NCBI-ProteinID:  XP_022607673 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MARVPLAVSVMLLLVLYSHGVSSAPAQHLCGSRLVDALYFVCGERGFFYSPNRPHKRDLE HLLGFLSKRARQEQRLWMALSDHDEPKVKRGIVEQCCHKPCSIYHLEGYCE NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggccagggtaccattggcagtgtccgtgatgctactgctggtgctctactcccacggg gtgtcctcggcccctgcccagcacctgtgtgggtcccgcttggtggatgccctctacttc gtatgtggagaacggggctttttctacagtccaaaccgaccccacaagcgggatctggaa catcttctcgggttcctgtctaaaagggccagacaggagcagcggctgtggatggctctg tctgaccatgatgagcccaaggtgaagagaggcatcgtggagcagtgctgccataagcca tgcagcatttaccacctggaggggtactgcgagtga

DBGET integrated database retrieval system