Seriola dumerili (greater amberjack): 111227963 Help Entry 111227963         CDS       T05606                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism sdu  Seriola dumerili (greater amberjack) Pathway sdu04010   MAPK signaling pathway sdu04137   Mitophagy - animal sdu04140   Autophagy - animal sdu04218   Cellular senescence sdu04371   Apelin signaling pathway sdu04625   C-type lectin receptor signaling pathway sdu04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:sdu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111227963 (rras)    04371 Apelin signaling pathway     111227963 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111227963 (rras)    04137 Mitophagy - animal     111227963 (rras)   09143 Cell growth and death    04218 Cellular senescence     111227963 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     111227963 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     111227963 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sdu04147]     111227963 (rras)    04031 GTP-binding proteins [BR:sdu04031]     111227963 (rras) Exosome [BR:sdu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    111227963 (rras)   Exosomal proteins of bladder cancer cells    111227963 (rras) GTP-binding proteins [BR:sdu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     111227963 (rras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1 DUF6806 DUF3234 Motif Other DBs NCBI-GeneID:  111227963 NCBI-ProteinID:  XP_022609438 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSGEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL GTAGQEEFGAMREQYMRSGEGFLLVFALNDRGSYHEVQKFHTQILRVKDRDDFPMVLVGN KADLEQQRVISREDAQAFARENRIHYMEASAKNRYNVDEAFLELVQIIRRFQEMESPPPP ARHSGKQNSGGCPCVLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtggcgaagaggaaagattcaaactggtggtggtgggaggagggggggtggggaag agcgccctcaccatccagttcatccagtcctactttgtgtcagactacgaccccaccatc gaagactcctacaccaagatctgtaccgttgatggaaaggagacccggctggacatcttg ggcacagcaggtcaggaggagtttggggcgatgagggagcagtacatgcgctcaggagaa ggcttcctactggtgtttgcactcaatgaccgaggaagctaccatgaggtccagaaattc cacacccagatcctgagagtgaaggaccgggacgacttccccatggtgctggttggaaac aaggctgacttggaacagcaaagagtgatctccagggaggacgctcaggcctttgccaga gagaacaggatccactatatggaggcttcagccaagaaccgctacaacgtggatgaagcc ttcctggagctggtgcagatcatcagacggtttcaggagatggagagtcctcctcctccg gctcgtcactcaggcaaacagaacagtggcggctgtccctgtgtcctcctctga

DBGET integrated database retrieval system