Seriola dumerili (greater amberjack): 111230220 Help Entry 111230220         CDS       T05606                                  Name (RefSeq) GTPase HRas-like   KO K07827   GTPase KRas Organism sdu  Seriola dumerili (greater amberjack) Pathway sdu04010   MAPK signaling pathway sdu04012   ErbB signaling pathway sdu04068   FoxO signaling pathway sdu04137   Mitophagy - animal sdu04140   Autophagy - animal sdu04150   mTOR signaling pathway sdu04210   Apoptosis sdu04218   Cellular senescence sdu04370   VEGF signaling pathway sdu04371   Apelin signaling pathway sdu04540   Gap junction sdu04625   C-type lectin receptor signaling pathway sdu04810   Regulation of actin cytoskeleton sdu04910   Insulin signaling pathway sdu04912   GnRH signaling pathway sdu04914   Progesterone-mediated oocyte maturation sdu04916   Melanogenesis Brite KEGG Orthology (KO) [BR:sdu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111230220    04012 ErbB signaling pathway     111230220    04370 VEGF signaling pathway     111230220    04371 Apelin signaling pathway     111230220    04068 FoxO signaling pathway     111230220    04150 mTOR signaling pathway     111230220  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111230220    04137 Mitophagy - animal     111230220   09143 Cell growth and death    04210 Apoptosis     111230220    04218 Cellular senescence     111230220   09144 Cellular community - eukaryotes    04540 Gap junction     111230220   09142 Cell motility    04810 Regulation of actin cytoskeleton     111230220  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     111230220   09152 Endocrine system    04910 Insulin signaling pathway     111230220    04912 GnRH signaling pathway     111230220    04914 Progesterone-mediated oocyte maturation     111230220    04916 Melanogenesis     111230220  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sdu04131]     111230220   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:sdu04031]     111230220 Membrane trafficking [BR:sdu04131]  Endocytosis   Macropinocytosis    Ras GTPases     111230220 GTP-binding proteins [BR:sdu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     111230220 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N ATP_bind_1 Septin AAA_16 Motif Other DBs NCBI-GeneID:  111230220 NCBI-ProteinID:  XP_022612597 UniProt:  A0A3B4V0I5 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDVHLYREQINRVKDSDSVPMVLVGNKSDL STRTVETRQAQELARSYGVPFVETSAKTRQGVEEAFYSLVREIRRYKETNRSNKKSKKNT QRRCIIL NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagcttgtggtagtgggggcaggaggtgtggggaagagcgctctcacc atccagctcatccagaaccacttcgttgatgaatatgatccaaccatcgaggactcgtac agaaaacaggtggtgattgacggagagacgtgtctgttggacatcctggacactgcaggt caggaggagtacagcgccatgagggaccagtatatgaggacaggagagggcttcctctgt gtgtttgccatcaacaacaccaagtcctttgaggatgttcacctttacagagagcagatc aacagggtgaaagacagtgacagtgttcccatggtactggtggggaataagagcgacctg agtacccgcactgtggagacgcgacaggcgcaggagctggcacgaagctacggcgtgcca tttgtcgagacatctgccaagaccagacagggtgtagaagaagctttctattcgctggta cgggagattagaagatataaggagaccaaccgcagcaacaagaagagcaagaagaacact cagagacgctgcataatactatag

DBGET integrated database retrieval system