Seriola dumerili (greater amberjack): 111232134 Help Entry 111232134         CDS       T05606                                  Symbol rab8a Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism sdu  Seriola dumerili (greater amberjack) Pathway sdu04140   Autophagy - animal sdu04144   Endocytosis sdu04530   Tight junction Brite KEGG Orthology (KO) [BR:sdu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111232134 (rab8a)    04140 Autophagy - animal     111232134 (rab8a)   09144 Cellular community - eukaryotes    04530 Tight junction     111232134 (rab8a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sdu04131]     111232134 (rab8a)    03036 Chromosome and associated proteins [BR:sdu03036]     111232134 (rab8a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sdu04147]     111232134 (rab8a)    04031 GTP-binding proteins [BR:sdu04031]     111232134 (rab8a) Membrane trafficking [BR:sdu04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     111232134 (rab8a)  Autophagy   Other autophagy associated proteins     111232134 (rab8a) Chromosome and associated proteins [BR:sdu03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     111232134 (rab8a) Exosome [BR:sdu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111232134 (rab8a)   Exosomal proteins of other body fluids (saliva and urine)    111232134 (rab8a)   Exosomal proteins of colorectal cancer cells    111232134 (rab8a) GTP-binding proteins [BR:sdu04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     111232134 (rab8a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB MMR_HSR1 Septin DUF3963 Tor_FN3_2nd AAA_7 Motif Other DBs NCBI-GeneID:  111232134 NCBI-ProteinID:  XP_022615223 LinkDB All DBs Position Unknown AA seq 206 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVERMVLG NKCDVNDKRQVSKERGEKLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDKKLEGN NPQGSSQGVKITEQPKKSSFFRCTLL NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacttacgattacttgtttaaactacttttaatcggcgattcaggcgtcgga aagacctgcgtgctattcagattttcagaagatgccttcaactcaacgtttatctctact ataggaattgacttcaagatcagaacaatagaattagatgggaaaaagatcaaactacag atatgggatacagcaggacaggagaggttcaggaccatcacaacagcctactacagagga gccatgggcatcatgttagtgtatgacattaccaacgagaaatcctttgacaacatcaag aactggatacggaatatagaagagcatgcctcagcagatgtggagaggatggtccttggg aacaaatgtgatgtcaatgacaagcgacaggtgtccaaagaaagaggagaaaagctggcg ctggaatatggtatcaagttcatggagaccagtgcaaaggcgaacatcaatgtcgagaat gccttcttaaccctcgccagagacatcaaagcaaaaatggacaagaagctggagggcaac aacccgcagggcagcagtcaaggagtaaagattactgagcagcccaagaaaagcagtttc ttccgctgcacactcctgtga

DBGET integrated database retrieval system