Seriola dumerili (greater amberjack): 111237572 Help Entry 111237572         CDS       T05606                                  Symbol dpy30 Name (RefSeq) protein dpy-30 homolog   KO K14965   protein dpy-30 Organism sdu  Seriola dumerili (greater amberjack) Brite KEGG Orthology (KO) [BR:sdu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sdu03036]     111237572 (dpy30) Chromosome and associated proteins [BR:sdu03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      111237572 (dpy30)     MLL-HCF complex      111237572 (dpy30)     MLL3/MLL4 complex      111237572 (dpy30) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dpy-30 Motif Other DBs NCBI-GeneID:  111237572 NCBI-ProteinID:  XP_022622436 UniProt:  A0A3B4VL31 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MADDHTDADQSMEGHTPVSENPHAEYGLTDNIQRTGENEKASAEKLSKQKVDLQALPTRA YLDQTVVPILLQGLSVLAKERPPNPIEYLAAFLLKNKSQFEERS NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggcggacgatcacacagacgcagatcagtcgatggagggacacactcctgtgtctgaa aaccctcacgcagagtacggcctgacagacaacatccagaggacgggggagaacgagaag gcgagtgcagagaagctgtctaagcagaaggtggacctgcaggccctgcccaccagagcg tacctggaccagaccgtggtccccatcctgctgcagggcctgtcagtgctcgccaaagag agacctccgaaccccatcgagtacctggcggcgttcctgctcaagaacaaatctcagttt gaagagagaagttag

DBGET integrated database retrieval system