Seriola dumerili (greater amberjack): 111238869 Help Entry 111238869         CDS       T05606                                  Symbol arf5 Name (RefSeq) ADP-ribosylation factor 5   KO K07939   ADP-ribosylation factor 4 Organism sdu  Seriola dumerili (greater amberjack) Pathway sdu04144   Endocytosis Brite KEGG Orthology (KO) [BR:sdu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111238869 (arf5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sdu04131]     111238869 (arf5)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sdu04147]     111238869 (arf5)    04031 GTP-binding proteins [BR:sdu04031]     111238869 (arf5) Membrane trafficking [BR:sdu04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     111238869 (arf5) Exosome [BR:sdu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111238869 (arf5)   Exosomal proteins of other body fluids (saliva and urine)    111238869 (arf5)   Exosomal proteins of colorectal cancer cells    111238869 (arf5) GTP-binding proteins [BR:sdu04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     111238869 (arf5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc SRPRB G-alpha Ras Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SRP54 LepB_N AAA_18 Motif Other DBs NCBI-GeneID:  111238869 NCBI-ProteinID:  XP_022624301 LinkDB All DBs Position Unknown AA seq 180 aa AA seqDB search MGLTISSLFSRFFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVAESAEELSKMIQEDELKEAV LLVFANKQDLPNAMGVSELTDKLGLHSLRSRTWHVQATCATQGTGLYEGLDWLSNELSKR NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgggcctgacgatctcgtctctgttctcccggtttttcgggaagaagcagatgaggatc ctgatggtgggtttggacgcagctggaaaaacaacgatcctctacaaactgaagctcgga gagatcgtcaccactatcccaactatcggctttaatgtggagacagtcgagtacaagaac atctgtttcacggtctgggacgtcggtggtcaggacaagatcagacctctgtggagacac tacttccagaacactcagggtctgatctttgtagtggacagtaatgacagagagagagta gcagagtctgcggaggaactctccaagatgatccaggaggacgagttgaaggaggcggtt cttctggtgtttgctaacaaacaggatcttcccaacgccatgggagtcagtgaactcacc gacaaactgggtctgcacagcctgcgcagcagaacttggcacgttcaggccacctgtgcc actcagggtacaggtctctacgagggtctggactggctgtccaatgagctgtcaaaacgc tag

DBGET integrated database retrieval system