Sulfitobacter dubius: R1T39_03170
Help
Entry
R1T39_03170 CDS
T09506
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulator PhoB
KO
K07657
two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
sdub
Sulfitobacter dubius
Pathway
sdub02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
sdub00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
R1T39_03170 (phoB)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
sdub02022
]
R1T39_03170 (phoB)
Two-component system [BR:
sdub02022
]
OmpR family
PhoR-PhoB (phosphate starvation response)
R1T39_03170 (phoB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Trans_reg_C
PDE8A_N
GlnR_1st
VpsR
HTH_11
OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID:
WOI29723
LinkDB
All DBs
Position
637187..637876
Genome browser
AA seq
229 aa
AA seq
DB search
MDVTRPQVLLVEDEPAQREVLAYNLEAEGFEVRRAEDGEEAMLLVSEAAPDLVILDWMMP
LMSGIEVCRQLKSRESTRHIPVIMLSARSEEVDTVRGLETGADDYVIKPYNLRELMARVR
TQLRRTRPAAAGALLSFDDIQLDPERHRVSRAGSELKLGPTEYRLLTTLLEKPGRVFSRD
QLLDHVWGRDIYVDTRTVDVHIARLRKALTREGGGDPIRTVRGAGYALG
NT seq
690 nt
NT seq
+upstream
nt +downstream
nt
atggacgtaacacggccacaggttttgctggtagaagacgagcccgcgcaacgtgaagtt
ttggcctataacctcgaagccgaaggctttgaggtgcgccgagccgaagatggcgaagaa
gcgatgcttctggtgtcagaagccgcgcccgatctggtgatcctcgattggatgatgccc
ttgatgagcggcatcgaagtctgccgccagttgaagtcgcgggaaagcacgcggcatatc
ccggtcatcatgctctcggcgcgatccgaagaagtggacaccgttcgaggcctcgaaacc
ggtgcggacgattatgtgatcaagccatacaatctgcgtgaactcatggcgcgtgtacgg
acgcaactacgccgaacccggccagcggccgcaggcgcgcttctcagctttgatgacata
cagctcgatccagaacgtcaccgtgtgagccgtgcgggcagcgagttaaagttgggaccg
actgagtaccgattgctgacaacgttgctggaaaaacccggccgggtgttcagccgtgat
caattgctcgatcatgtttggggccgcgatatctatgttgatacgcgcacggtcgatgtc
catatcgcacggctacgcaaagcattgacccgcgaaggcggtggcgatccgatcagaacc
gtacgtggcgcgggatacgccttaggttaa
DBGET
integrated database retrieval system