Solanum dulcamara (climbing nightshade): 129884772 Help Entry 129884772         CDS       T09577                                  Name (RefSeq) calmodulin isoform X1   KO K02183   calmodulin Organism sdul  Solanum dulcamara (climbing nightshade) Pathway sdul04016   MAPK signaling pathway - plant sdul04070   Phosphatidylinositol signaling system sdul04075   Plant hormone signal transduction sdul04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:sdul00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     129884772    04070 Phosphatidylinositol signaling system     129884772    04075 Plant hormone signal transduction     129884772  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     129884772  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sdul01009]     129884772   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sdul04131]     129884772    03036 Chromosome and associated proteins [BR:sdul03036]     129884772   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sdul04147]     129884772 Protein phosphatases and associated proteins [BR:sdul01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      129884772 Membrane trafficking [BR:sdul04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     129884772 Chromosome and associated proteins [BR:sdul03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      129884772 Exosome [BR:sdul04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    129884772 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like Fe_hyd_lg_C DUF6279 PhageMin_Tail MecA_N Motif Other DBs NCBI-GeneID:  129884772 NCBI-ProteinID:  XP_055815032 LinkDB All DBs Position 1:89445681..89458442 Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYDEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggatcagcttacagatgatcagatctctgagttcaaggaagccttcagccttttc gacaaagatggagatggttgcatcactactaaggagcttggaaccgtgatgcggtcgttg ggacaaaatccaactgaggctgagcttcaagacatgatcaatgaagttgatgctgatgga aatggaaccattgacttccccgagttccttaacttgatggctcggaagatgaaagacact gattctgaggaggagctcaaggaagctttcagggtgtttgataaggatcagaatggattt atttctgcagctgagctacgccatgtcatgacaaacctaggcgagaaacttacagatgaa gaggttgacgagatgattcgtgaagctgacgtggatggtgatggacagatcaactatgac gagttcgtcaaggtcatgatggccaagtga

DBGET integrated database retrieval system