Streptomyces davaonensis: BN159_5337 Help Entry BN159_5337        CDS       T02518                                  Name (GenBank) hypothetical protein   KO K03530   DNA-binding protein HU-beta Organism sdv  Streptomyces davaonensis Brite KEGG Orthology (KO) [BR:sdv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sdv03032]     BN159_5337    03036 Chromosome and associated proteins [BR:sdv03036]     BN159_5337    03400 DNA repair and recombination proteins [BR:sdv03400]     BN159_5337 DNA replication proteins [BR:sdv03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BN159_5337 Chromosome and associated proteins [BR:sdv03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BN159_5337 DNA repair and recombination proteins [BR:sdv03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BN159_5337 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta HU-HIG Motif Other DBs NCBI-ProteinID:  CCK29716 UniProt:  K4R0A2 LinkDB All DBs Position 5956675..5956956 Genome browser AA seq 93 aa AA seqDB search MNRSELVAALADRAEVTRKDADAVLAAFAETVGEIVAKGDEKVTIPGFLTFERTHRAART ARNPQTGDPIQIPAGYSVKVSAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgccctggccgaccgtgccgaggtgacccgcaaggac gccgacgccgtgctggccgcgttcgccgagaccgtcggcgagatcgtcgccaagggcgac gagaaggtcaccatccccggcttcctgaccttcgagcgcacccaccgtgccgctcgcacc gcgcgcaacccgcagaccggcgacccgatccagatcccggccggctacagcgtgaaggtt tcggcgggcagcaagctcaaggaagccgccaagggcaagtaa

DBGET integrated database retrieval system