Streptomyces decoyicus: K7C20_32770 Help Entry K7C20_32770       CDS       T07553                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism sdw  Streptomyces decoyicus Pathway sdw00253   Tetracycline biosynthesis sdw01056   Biosynthesis of type II polyketide backbone sdw01100   Metabolic pathways sdw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdw00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     K7C20_32770    00253 Tetracycline biosynthesis     K7C20_32770  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:sdw01004]     K7C20_32770    01008 Polyketide biosynthesis proteins [BR:sdw01008]     K7C20_32770 Lipid biosynthesis proteins [BR:sdw01004]  Polyketide synthase   Component type    K7C20_32770 Polyketide biosynthesis proteins [BR:sdw01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      K7C20_32770     Nonaketide PKS      K7C20_32770     Decaketide PKS      K7C20_32770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QZY19411 LinkDB All DBs Position 7525496..7525765 Genome browser AA seq 89 aa AA seqDB search MPITTTHVTLTDLTRMLRESAGEEEGVDLDGDVIDTPFIELGYDSLALLQVIGEIQREYG VEIPDDAVVDAETPRALLDLINAGSTSAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcccatcaccaccacccacgtcaccctcaccgacctcacccggatgctgcgcgagagc gcgggcgaggaggagggcgtcgacctggacggcgacgtcatcgacacgcccttcatcgag ctcggctacgactcgctcgcgctgctccaggtgatcggcgagatccagcgtgagtacggc gtggagatcccggacgacgcggtcgtcgacgccgagaccccgcgcgccctgctcgacctc atcaacgccggcagcacgtcggccgcatga

DBGET integrated database retrieval system