Streptomyces decoyicus: K7C20_33595 Help Entry K7C20_33595       CDS       T07553                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sdw  Streptomyces decoyicus Pathway sdw00998   Biosynthesis of various antibiotics sdw01100   Metabolic pathways sdw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K7C20_33595    00074 Mycolic acid biosynthesis     K7C20_33595   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K7C20_33595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QZY19550 LinkDB All DBs Position complement(7719275..7719508) Genome browser AA seq 77 aa AA seqDB search MKAAEVVNTLLVQRFGVSSVDIADETPLRSLRLDSLALEELRVLIEERLDIDLDEVSLTP RNTVGQLVSAVDGKVPA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtgaaagcggcagaagttgtcaacaccttgctggtccaacgattcggggtctcctcggtc gacatcgccgacgagactccgctgcgcagcctgcgcctcgactccctggcgctggaagaa ctccgcgtcctcatcgaggaacgactggacatcgacctcgacgaggtctcgctgacccca cggaacaccgtgggccagctggtatcggccgtcgacggcaaagtcccggcatga

DBGET integrated database retrieval system