Streptomyces dengpaensis: C4B68_13635 Help Entry C4B68_13635       CDS       T06611                                  Name (GenBank) NrdH-redoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism sdx  Streptomyces dengpaensis Brite KEGG Orthology (KO) [BR:sdx00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     C4B68_13635 Enzymes [BR:sdx01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      C4B68_13635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Glrx-like Thioredoxin GST_N_3 GST_N_2 Motif Other DBs NCBI-ProteinID:  AVH56644 LinkDB All DBs Position 3001447..3001704 Genome browser AA seq 85 aa AA seqDB search MPGTVTMYSTTWCGYCRRLKSQMDREGITYNEINIEQDPQSAAFVEKANGGNQTVPTLQI VSSSGGPAVVMTNPSLAQVKRALGV NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgccgggcactgtgacgatgtacagcaccacgtggtgcggctactgccgtcggctgaag agccagatggaccgcgagggcatcacgtacaacgagatcaacatcgagcaggacccgcag tccgcggcgttcgtggagaaggcgaacggcggaaaccagacggttccgactcttcagata gtttcctccagtggtgggcctgcggtcgtcatgacgaacccgagccttgcccaggtgaag cgggcgctcggcgtctga

DBGET integrated database retrieval system