Streptomyces dengpaensis: C4B68_24880 Help Entry C4B68_24880       CDS       T06611                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism sdx  Streptomyces dengpaensis Brite KEGG Orthology (KO) [BR:sdx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sdx03032]     C4B68_24880    03036 Chromosome and associated proteins [BR:sdx03036]     C4B68_24880    03400 DNA repair and recombination proteins [BR:sdx03400]     C4B68_24880 DNA replication proteins [BR:sdx03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     C4B68_24880 Chromosome and associated proteins [BR:sdx03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     C4B68_24880 DNA repair and recombination proteins [BR:sdx03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       C4B68_24880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta HU-HIG Motif Other DBs NCBI-ProteinID:  AVH58472 LinkDB All DBs Position 5371135..5371416 Genome browser AA seq 93 aa AA seqDB search MNRSELVAALADRAEVTRKDADAVLAAFAETVGEIVAKGDEKVTIPGFLTFERTHRAART ARNPQTGDPIQIPAGYSVKVSAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgcgctggccgaccgcgccgaggtgacccgcaaggac gccgacgccgttctggccgcgttcgccgagaccgtcggcgagatcgtcgccaagggcgac gagaaggtcaccatccccggcttcctgaccttcgagcgcacccaccgtgccgctcgtacc gcgcgtaacccgcagaccggcgacccgatccagatcccggccggctacagcgtgaaggtc tccgcgggcagcaagctcaaggaagccgccaagggcaagtaa

DBGET integrated database retrieval system