Streptomyces dengpaensis: C4B68_27765 Help Entry C4B68_27765       CDS       T06611                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sdx  Streptomyces dengpaensis Pathway sdx00998   Biosynthesis of various antibiotics sdx01100   Metabolic pathways sdx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C4B68_27765    00074 Mycolic acid biosynthesis     C4B68_27765   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C4B68_27765 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AVH58932 LinkDB All DBs Position complement(6013149..6013397) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVEGLAEIVNEIAGIPTEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATDYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgaaggtctcgccgagatcgtgaacgagatcgcc gggatccccaccgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgctgaagagcgcttcgacgtgaagatcccg gacgacgacgtcaagaacctcaagaccgtcggcgacgccacggactacatcctcaagcac caggcctga

DBGET integrated database retrieval system