Streptomyces dengpaensis: C4B68_37105 Help Entry C4B68_37105       CDS       T06611                                  Name (GenBank) hypothetical protein   KO K00128   aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] Organism sdx  Streptomyces dengpaensis Pathway sdx00010   Glycolysis / Gluconeogenesis sdx00053   Ascorbate and aldarate metabolism sdx00071   Fatty acid degradation sdx00280   Valine, leucine and isoleucine degradation sdx00310   Lysine degradation sdx00330   Arginine and proline metabolism sdx00340   Histidine metabolism sdx00380   Tryptophan metabolism sdx00410   beta-Alanine metabolism sdx00561   Glycerolipid metabolism sdx00620   Pyruvate metabolism sdx00625   Chloroalkane and chloroalkene degradation sdx00770   Pantothenate and CoA biosynthesis sdx00903   Limonene degradation sdx01100   Metabolic pathways sdx01110   Biosynthesis of secondary metabolites sdx01120   Microbial metabolism in diverse environments sdx01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:sdx00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     C4B68_37105    00053 Ascorbate and aldarate metabolism     C4B68_37105    00620 Pyruvate metabolism     C4B68_37105   09103 Lipid metabolism    00071 Fatty acid degradation     C4B68_37105    00561 Glycerolipid metabolism     C4B68_37105   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     C4B68_37105    00310 Lysine degradation     C4B68_37105    00330 Arginine and proline metabolism     C4B68_37105    00340 Histidine metabolism     C4B68_37105    00380 Tryptophan metabolism     C4B68_37105   09106 Metabolism of other amino acids    00410 beta-Alanine metabolism     C4B68_37105   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     C4B68_37105   09109 Metabolism of terpenoids and polyketides    00903 Limonene degradation     C4B68_37105   09111 Xenobiotics biodegradation and metabolism    00625 Chloroalkane and chloroalkene degradation     C4B68_37105 Enzymes [BR:sdx01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.1  With NAD+ or NADP+ as acceptor     1.2.1.3  aldehyde dehydrogenase (NAD+)      C4B68_37105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Aldedh Motif Other DBs NCBI-ProteinID:  AVH60479 LinkDB All DBs Position 7967016..7967441 Genome browser AA seq 141 aa AA seqDB search MVVGGVELSAAYSALPFHHPMLTCSPGVGELVRRAAAEHLTPVTLELGCQNPVVVGHDAD LADAAGARDCPTTDSSASARTTSSRRWTSATSRMGLSPALGIGDGLESQYRGNPAGGDER RLTGPVEHVDRRVAARHATGK NT seq 426 nt NT seq  +upstreamnt  +downstreamnt gtggtcgtcggcggggtcgagctgagcgcggcatactcggccctgccgttccaccacccg atgctcacgtgctctcccggcgtgggcgagttggtccggagggcggcagcggaacacctc accccggtcacccttgaactcggctgccagaacccggtcgtggtgggccatgacgccgac ctcgcggacgccgcgggggctcgcgactgtccaacgacggacagttccgcctcggcccgg accacgtcttcgcgccgatggacctcggcaacatcacggatgggcctcagcccggcgctc gggatcggggatggtctggagagccagtaccgcggcaacccggctgggggcgatgaacgc cgactgaccggacctgtagagcacgtggaccgccgggtggccgcccgacacgctacgggg aagtga

DBGET integrated database retrieval system