Shigella dysenteriae Sd197: SDY_2056 Help Entry SDY_2056          CDS       T00306                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sdy  Shigella dysenteriae Sd197 Pathway sdy01100   Metabolic pathways sdy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SDY_2056 (acpP)    00074 Mycolic acid biosynthesis     SDY_2056 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SDY_2056 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  ABB62151 ShiBASE_China:  SDY2056 UniProt:  Q32EV4 LinkDB All DBs Position complement(1868138..1868374) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system