Shigella dysenteriae Sd197: SDY_2081 Help Entry SDY_2081          CDS       T00306                                  Symbol flgM Name (GenBank) anti-FliA factor   KO K02398   negative regulator of flagellin synthesis FlgM Organism sdy  Shigella dysenteriae Sd197 Pathway sdy02020   Two-component system sdy02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:sdy00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     SDY_2081 (flgM)  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     SDY_2081 (flgM)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:sdy02035]     SDY_2081 (flgM) Bacterial motility proteins [BR:sdy02035]  Flagellar system   Flagellar assembly proteins    Others     SDY_2081 (flgM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  ABB62173 ShiBASE_China:  SDY2081 UniProt:  Q32ET2 LinkDB All DBs Position 1891347..1891640 Genome browser AA seq 97 aa AA seqDB search MSIDRTSPLKPVSTVQPRETTDAPVTNTRAAKTTASTSTSVTLSDAQAKLMQPGSSDINL ERVEALKLAIRNGELKMDTGKIADALINEAQQDLQSN NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagtattgatcgcacttcgcctctgaagcccgtaagcaccgttcaaccgcgcgaaacc actgacgcgccggtaacgaacacccgagcggcaaaaacaacagcatccaccagcaccagt gtgacgttaagcgacgcgcaagcaaaactgatgcaacccggcagcagtgatatcaatctt gaacgtgtcgaagcgttaaaactggcgattcgtaacggtgaactaaaaatggacaccggc aaaattgccgatgcgctgatcaacgaagcgcagcaagacttgcagagtaattaa

DBGET integrated database retrieval system