Shigella dysenteriae Sd197: SDY_2936 Help Entry SDY_2936          CDS       T00306                                  Name (GenBank) conserved hypothetical protein   KO K21759   vanillate/4-hydroxybenzoate decarboxylase subunit D [EC:4.1.1.- 4.1.1.61] Organism sdy  Shigella dysenteriae Sd197 Pathway sdy00627   Aminobenzoate degradation sdy01120   Microbial metabolism in diverse environments sdy01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:sdy00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00627 Aminobenzoate degradation     SDY_2936 Enzymes [BR:sdy01000]  4. Lyases   4.1  Carbon-carbon lyases    4.1.1  Carboxy-lyases     4.1.1.61  4-hydroxybenzoate decarboxylase      SDY_2936 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EcdD_BsdD_detox DUF1062 zf-C2H2_7th_ZNF462 DUF982 DUF6504 DUF5795 Motif Other DBs NCBI-ProteinID:  ABB62962 ShiBASE_China:  SDY2936 UniProt:  Q32CJ3 LinkDB All DBs Position complement(2716734..2716970) Genome browser AA seq 78 aa AA seqDB search MICPRRADEQIEVMAKSPVKDVWTVYQCQHCLYTWRDTEPLRRTSREHYPEAFRMTQKDI DDAPMVPSIPPLLAEGKR NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgatttgtccacgtcgtgccgatgaacagattgaagtgatggcgaaatcgccggtgaaa gatgtctggacggtatatcagtgccagcattgcctttatacctggcgcgataccgaaccg ctgcgccgtaccagccgcgaacattatcccgaagcgttccgcatgacgcagaaagatatt gatgacgcgccaatggtgccgagcatcccgccgctgctggcggaaggtaagcgctaa

DBGET integrated database retrieval system