Shigella dysenteriae Sd197: SDY_3834
Help
Entry
SDY_3834 CDS
T00306
Symbol
cpxR
Name
(GenBank) transcriptional regulator in 2-component system
KO
K07662
two-component system, OmpR family, response regulator CpxR
Organism
sdy
Shigella dysenteriae Sd197
Pathway
sdy01503
Cationic antimicrobial peptide (CAMP) resistance
sdy02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
sdy00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
SDY_3834 (cpxR)
09160 Human Diseases
09175 Drug resistance: antimicrobial
01503 Cationic antimicrobial peptide (CAMP) resistance
SDY_3834 (cpxR)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
sdy02022
]
SDY_3834 (cpxR)
Two-component system [BR:
sdy02022
]
OmpR family
CpxA-CpxR (envelope stress response)
SDY_3834 (cpxR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Trans_reg_C
FleQ
BRCT_3
Motif
Other DBs
NCBI-ProteinID:
ABB63778
ShiBASE_China:
SDY3834
UniProt:
Q32A77
LinkDB
All DBs
Position
3566576..3567274
Genome browser
AA seq
232 aa
AA seq
DB search
MNKILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDDSIDLLLLDVMMPKKNGI
DTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHW
SEQQQNNDNGSPTLEVDALVLNPGRQEASFDGQTLELTGTEFTLLYLLAQHLGQVVSREH
LSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDGHPWFKTLRGRGYLMVSAS
NT seq
699 nt
NT seq
+upstream
nt +downstream
nt
atgaataaaatcctgttagttgatgatgaccgagagctgacttccctattaaaggagctg
ctcgagatggaaggcttcaacgtgattgttgcccacgatggggaacaggcgcttgatctt
ctggacgacagcattgatttacttttgcttgacgtaatgatgccgaagaaaaatggtatc
gacacattaaaagcacttcgccagacacaccagacgcctgtcattatgttgacggcgcgc
ggcagtgaacttgatcgcgttctcggccttgagctgggcgcagatgactatctcccgaaa
ccgtttaatgatcgtgagctggtggcacgtattcgcgcgatcctgcgccgttcgcactgg
agcgagcaacagcaaaacaacgacaacggttcaccgacactggaagttgatgccttagtg
ctgaatccaggccgtcaggaagccagcttcgacgggcaaacgctggagttaaccggtact
gagtttaccctgctctatttgctggcacagcatctgggtcaggtggtttcccgtgagcat
ttaagccaggaagtgctgggcaaacgcctgacgcctttcgaccgcgctatcgatatgcac
atttccaacctgcgtcgtaaactgccggatcgtaaagatggtcacccgtggtttaaaacc
ttgcgtggtcgcggctacctgatggtttctgcttcatga
DBGET
integrated database retrieval system