KEGG   Shigella dysenteriae Sd197: SDY_3834
Entry
SDY_3834          CDS       T00306                                 
Symbol
cpxR
Name
(GenBank) transcriptional regulator in 2-component system
  KO
K07662  two-component system, OmpR family, response regulator CpxR
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy01503  Cationic antimicrobial peptide (CAMP) resistance
sdy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sdy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SDY_3834 (cpxR)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SDY_3834 (cpxR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sdy02022]
    SDY_3834 (cpxR)
Two-component system [BR:sdy02022]
 OmpR family
  CpxA-CpxR (envelope stress response)
   SDY_3834 (cpxR)
SSDB
Motif
Pfam: Response_reg Trans_reg_C FleQ BRCT_3
Other DBs
NCBI-ProteinID: ABB63778
ShiBASE_China: SDY3834
UniProt: Q32A77
LinkDB
Position
3566576..3567274
AA seq 232 aa
MNKILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDDSIDLLLLDVMMPKKNGI
DTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHW
SEQQQNNDNGSPTLEVDALVLNPGRQEASFDGQTLELTGTEFTLLYLLAQHLGQVVSREH
LSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDGHPWFKTLRGRGYLMVSAS
NT seq 699 nt   +upstreamnt  +downstreamnt
atgaataaaatcctgttagttgatgatgaccgagagctgacttccctattaaaggagctg
ctcgagatggaaggcttcaacgtgattgttgcccacgatggggaacaggcgcttgatctt
ctggacgacagcattgatttacttttgcttgacgtaatgatgccgaagaaaaatggtatc
gacacattaaaagcacttcgccagacacaccagacgcctgtcattatgttgacggcgcgc
ggcagtgaacttgatcgcgttctcggccttgagctgggcgcagatgactatctcccgaaa
ccgtttaatgatcgtgagctggtggcacgtattcgcgcgatcctgcgccgttcgcactgg
agcgagcaacagcaaaacaacgacaacggttcaccgacactggaagttgatgccttagtg
ctgaatccaggccgtcaggaagccagcttcgacgggcaaacgctggagttaaccggtact
gagtttaccctgctctatttgctggcacagcatctgggtcaggtggtttcccgtgagcat
ttaagccaggaagtgctgggcaaacgcctgacgcctttcgaccgcgctatcgatatgcac
atttccaacctgcgtcgtaaactgccggatcgtaaagatggtcacccgtggtttaaaacc
ttgcgtggtcgcggctacctgatggtttctgcttcatga

DBGET integrated database retrieval system