Shigella dysenteriae Sd197: SDY_P162 Help Entry SDY_P162          CDS       T00306                                  Symbol acp Name (GenBank) Acp   KO K02078   acyl carrier protein Organism sdy  Shigella dysenteriae Sd197 Pathway sdy01100   Metabolic pathways sdy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SDY_P162 (acp)    00074 Mycolic acid biosynthesis     SDY_P162 (acp)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SDY_P162 (acp) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  ABB64675 ShiBASE_China:  SDYP162 UniProt:  Q326T3 LinkDB All DBs Position pSD1_197:complement(129030..129266) Genome browser AA seq 78 aa AA seqDB search MIKERILSIVAFCYGIAYSKLSEETKFIEDLSADSLSLIEMLDMISFEFNLRIDESALEH IITIGDLISVVKNSTKSI NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgataaaagaaagaatattatcaatagtggccttttgctatggtatagcgtacagcaaa ctatctgaagaaactaaatttattgaagatctttctgccgattctctttctctgattgaa atgctggatatgattagttttgagttcaatctacgtatagatgaatctgcattagaacac attattactattggagatcttatttctgtagtcaaaaatagtacaaaatcaatatag

DBGET integrated database retrieval system