Shigella dysenteriae Sd197: SDY_P194 Help Entry SDY_P194          CDS       T00306                                  Symbol spa-orf10 Name (GenBank) conserved hypothetical protein   KO K21976   probable RcsB/C two-component-system connector, global regulator of biofilm formation and acid-resistance Organism sdy  Shigella dysenteriae Sd197 Brite KEGG Orthology (KO) [BR:sdy00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99995 Signaling proteins     SDY_P194 (spa-orf10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YmgB Motif Other DBs NCBI-ProteinID:  ABB64707 ShiBASE_China:  SDYP194 UniProt:  Q326Q1 LinkDB All DBs Position pSD1_197:157540..157773 Genome browser AA seq 77 aa AA seqDB search MGVNFCNKIGIDQSEFEIESSIINSIANEVLNPISFLSNKDIINVLLRKISSECDLVRKD IYRCALELVVEKTPDDL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgggagttaatttctgtaataaaataggtattgatcagtctgaatttgaaatagaatct tccatcattaactccattgctaatgaggtattgaacccaatatctttccttagcaacaag gatataataaatgttttactcagaaagatttcatctgaatgtgacctggttagaaaagac atttatcgttgtgctctggagttggtcgttgaaaaaacacctgatgatttataa

DBGET integrated database retrieval system