Symmachiella dynata: Mal52_25290 Help Entry Mal52_25290       CDS       T06944                                  Name (GenBank) Anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism sdyn  Symmachiella dynata Pathway sdyn02020   Two-component system sdyn02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:sdyn00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Mal52_25290  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Mal52_25290  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:sdyn02035]     Mal52_25290 Bacterial motility proteins [BR:sdyn02035]  Flagellar system   Flagellar assembly proteins    Others     Mal52_25290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM DUF3450 Motif Other DBs NCBI-ProteinID:  QDU44051 UniProt:  A0A517ZNL9 LinkDB All DBs Position 3109990..3110280 Genome browser AA seq 96 aa AA seqDB search MDVTGPSTVNGAVPINRPAVMKPVTPAAQTAPISPQDEVEISAAGRALGDLGKSPELRQE RIAQIKAAIDDGTYETHEKFDIAMSRLLDRIDSGGV NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggatgtcaccggtcccagcacggtcaacggcgcagtgccgattaatcgcccagcggtt atgaaacctgtcaccccagcagcgcaaacggctcctatctcgccgcaagacgaagtcgaa atctcagcagcaggtcgcgcgttaggcgatctgggcaagtcgcccgaattgcgacaggag cgtattgcacaaattaaagccgccatcgacgatggcacttacgaaacccacgaaaaattt gatatcgccatgagccggcttctggaccgaatcgatagcggcggagtttag

DBGET integrated database retrieval system