Shigella dysenteriae 1617 (serotype 1): Asd1617_02760 Help Entry Asd1617_02760     CDS       T02933                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism sdz  Shigella dysenteriae 1617 (serotype 1) Pathway sdz01100   Metabolic pathways sdz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Asd1617_02760    00074 Mycolic acid biosynthesis     Asd1617_02760   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Asd1617_02760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AHA65587 UniProt:  E2XFG3 LinkDB All DBs Position complement(1828869..1829105) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system