Shigella dysenteriae 1617 (serotype 1): Asd1617_05293 Help Entry Asd1617_05293     CDS       T02933                                  Name (GenBank) Glutaredoxin   KO K03676   glutaredoxin 3 Organism sdz  Shigella dysenteriae 1617 (serotype 1) Brite KEGG Orthology (KO) [BR:sdz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sdz03110]     Asd1617_05293 Chaperones and folding catalysts [BR:sdz03110]  Protein folding catalysts   Protein disulfide isomerase    Asd1617_05293 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR GST_N Thioredoxin_2 Thioredoxin_3 CLIC-like_N Motif Other DBs NCBI-ProteinID:  AHA68120 UniProt:  E2X4U0 LinkDB All DBs Position complement(3727619..3727870) Genome browser AA seq 83 aa AA seqDB search MANVEIYTKETCPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGRTTVPQIFIDA QHIGGCDDLYALDARGGLDPLLK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggccaatgttgaaatctataccaaagaaacctgcccgtattgccatcgtgcaaaagca ctgctgagcagcaagggcgtgagtttccaggagctgccgatcgatggcaacgccgccaag cgtgaagagatgatcaaacgcagcggtcgcaccacggttccccagatttttattgacgca cagcacattggcggctgtgatgacttgtatgcattggatgcacgtggtggactggatccc ctgctgaaataa

DBGET integrated database retrieval system