Staphylococcus edaphicus: MNY58_08450 Help Entry MNY58_08450       CDS       T09108                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism seda  Staphylococcus edaphicus Pathway seda01100   Metabolic pathways seda01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:seda00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MNY58_08450    00074 Mycolic acid biosynthesis     MNY58_08450   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MNY58_08450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  UQW80626 LinkDB All DBs Position complement(1756732..1756965) Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDAEKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVKFINSIEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgacaaagtaaaagacattatcgttgaccgtttaggtgttgacgctgaa aaagtaactgaagatgcatcttttaaagatgatttaggcgctgactcacttgatatcgct gaattagttatggaattagaagatgaatttggtactgaaattcctgatgaagaagctgaa aaaatcaacacagttggtgacgcagttaaatttattaacagtattgaaaaataa

DBGET integrated database retrieval system