Parasedimentitalea marina: EBB79_05160
Help
Entry
EBB79_05160 CDS
T05780
Name
(GenBank) NADH-quinone oxidoreductase subunit J
KO
K00339
NADH-quinone oxidoreductase subunit J [EC:
7.1.1.2
]
Organism
sedi
Parasedimentitalea marina
Pathway
sedi00190
Oxidative phosphorylation
sedi01100
Metabolic pathways
Module
sedi_M00144
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:
sedi00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
EBB79_05160
Enzymes [BR:
sedi01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
EBB79_05160
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Oxidored_q3
MbhD
Kei1
Motif
Other DBs
NCBI-ProteinID:
AZV77336
UniProt:
A0A3T0MZZ0
LinkDB
All DBs
Position
1049003..1049554
Genome browser
AA seq
183 aa
AA seq
DB search
MEREFFLLLSGVATISGLLVVVARNPIHSALALVACLVQIAAIYILLGAPFLAVIQIFVY
VGAVMVLFLFVIMMLDVRKEAQTRYLRGAAWPGVIVLLLLAAELFALLIQSTRLHAVMGP
GQPISQQPSVEDLSLLLFQDFLLPFEVASVILLVALVGAVVLARTDDKAAGVSADRSQQR
GRQ
NT seq
552 nt
NT seq
+upstream
nt +downstream
nt
atggagcgcgagttttttctgctgttgtcgggtgttgcaaccatatcaggcctgctggtg
gtggtggcgcgcaatcctatccacagtgctctggcgttggttgcctgtctggttcagatc
gctgccatatacatcctgctgggcgcgccatttttggctgtgatccagatttttgtctat
gtcggcgcggtgatggtgctgttcttgtttgtcatcatgatgctggatgtccgcaaagag
gcgcagaccagatacctgagaggtgccgcttggcccggtgtcattgtgttgctgcttctg
gcggctgaactgtttgccctgttgatacaaagtactcggctgcatgcggtcatgggaccg
ggtcaaccgatcagccagcagccctcggtcgaagatctcagtctcttgttgttccaggat
ttcttgctgccgtttgaggtggcctcggtgatcttattggtggctttggtcggcgcagtg
gtgttggcccgtacggatgacaaggcggcaggagtgagcgcagacaggtctcaacagagg
ggccgccaatga
DBGET
integrated database retrieval system