Parasedimentitalea marina: EBB79_15735 Help Entry EBB79_15735       CDS       T05780                                  Name (GenBank) hypothetical protein   KO K00887   undecaprenol kinase [EC:2.7.1.66] Organism sedi  Parasedimentitalea marina Pathway sedi00550   Peptidoglycan biosynthesis Brite KEGG Orthology (KO) [BR:sedi00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00550 Peptidoglycan biosynthesis     EBB79_15735 Enzymes [BR:sedi01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.1  Phosphotransferases with an alcohol group as acceptor     2.7.1.66  undecaprenol kinase      EBB79_15735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DAGK_prokar Motif Other DBs NCBI-ProteinID:  AZV79186 UniProt:  A0A3T0N583 LinkDB All DBs Position complement(3213872..3214042) Genome browser AA seq 56 aa AA seqDB search METGEHGLIPALGVLVLAAKLFNTAIERVVDYISAEQHPLAGQVKDAGSAGRAPAA NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atggaaaccggcgagcacggcctgatcccggcgctgggcgtgttggttctggcggccaag ctgttcaataccgcgattgagcgggtggtggattatatatcagcagagcagcacccgctg gccgggcaggtcaaggacgcgggcagtgcagggagggcacccgctgcatga

DBGET integrated database retrieval system