Sedimenticola thiotaurini: AAY24_05215 Help Entry AAY24_05215       CDS       T03943                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism seds  Sedimenticola thiotaurini Pathway seds02024   Quorum sensing seds03018   RNA degradation Brite KEGG Orthology (KO) [BR:seds00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AAY24_05215  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AAY24_05215  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:seds03019]     AAY24_05215    03036 Chromosome and associated proteins [BR:seds03036]     AAY24_05215 Messenger RNA biogenesis [BR:seds03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AAY24_05215 Chromosome and associated proteins [BR:seds03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AAY24_05215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AKH19851 UniProt:  A0A0F7JTL4 LinkDB All DBs Position complement(1169164..1169418) Genome browser AA seq 84 aa AA seqDB search MSKGQSLQDPFLNTLRKERIPVSIFLVNGIKLQGQIESFDQFVVLLKNTVSQMVYKHAIS TVVPARNVRLQMPGSDDATELGNS NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgtctaaggggcaaagtctacaggaccctttcctcaacacgcttcgaaaagagcgtatt cccgtatcgatcttcctggtgaatggaatcaagctacaggggcagattgaatcgtttgat cagtttgtggtattgctgaaaaatacggtcagtcaaatggtatataaacatgccatttcc actgtggttcccgcgaggaatgtgcggttgcagatgccgggtagtgatgacgccaccgaa ctcggcaatagctga

DBGET integrated database retrieval system