Sedimentibacter sp. zth1: JYG23_01610 Help Entry JYG23_01610       CDS       T07110                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism sedz  Sedimentibacter sp. zth1 Pathway sedz00020   Citrate cycle (TCA cycle) sedz00720   Other carbon fixation pathways sedz01100   Metabolic pathways sedz01110   Biosynthesis of secondary metabolites sedz01120   Microbial metabolism in diverse environments sedz01200   Carbon metabolism sedz01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:sedz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     JYG23_01610   09102 Energy metabolism    00720 Other carbon fixation pathways     JYG23_01610 Enzymes [BR:sedz01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      JYG23_01610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_21 Fer4_2 Fer4_6 Fer4_9 Fer4_16 LdpA_Fe-S-bd Fer4_15 Fer4_4 Fer4_22 Fer4_17 Fer4_3 Fer4_13 Fer4_8 Fer4_18 Motif Other DBs NCBI-ProteinID:  QSX06188 LinkDB All DBs Position 332627..332842 Genome browser AA seq 71 aa AA seqDB search MAKGKVTFNEDICKGCELCVMACPKNLISMNTEKINKKGYNAAYIANPEECIGCGNCAVM CPDSVITVERI NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggctaaaggtaaagtaacatttaatgaggacatttgcaaaggctgtgaactatgtgtt atggcatgtcctaaaaatctaatcagtatgaatactgaaaaaattaataaaaaaggatac aatgctgcttatatagcaaatcctgaagaatgtatcggatgcggaaattgtgcagtaatg tgtccagattcagtaataacagtagaaagaatataa

DBGET integrated database retrieval system