KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67: SPUCDC_4441
Entry
SPUCDC_4441       CDS       T02824                                 
Symbol
yjgP
Name
(GenBank) putative inner membrane protein
  KO
K07091  lipopolysaccharide export system permease protein
Organism
sega  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67
Pathway
sega02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sega00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SPUCDC_4441 (yjgP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sega02000]
    SPUCDC_4441 (yjgP)
Transporters [BR:sega02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    SPUCDC_4441 (yjgP)
SSDB
Motif
Pfam: LptF_LptG Claudin_2 HemY_N
Other DBs
NCBI-ProteinID: AGU67168
LinkDB
Position
4500682..4501689
AA seq 335 aa
MRILGAAVDGDIPANLVLSLLGLGVPEMAQLILPLSLFLGLLMTLGKLYTESEITVMHAC
GLSKAVLVKAAMVLALFTGILAAVNVMWAGPWSSKHQDEVLAEAKANPGMAALAQGQFQQ
ATNGSSVLFIESVDGSDFHDVFLAQIRPKGNARPSVVVADSGHLTQLRDGSQVVTLNKGT
RFEGTALLRDFRITDFQNYQAIIGHQAVALDPNDTDQMDMRTLWNTDNDRARAELHWRIT
LVFTVFMMALMVVPLSVVNPRQGRVLSMLPAMLLYLLFFLIQTSIKSNGGKGKLDPVIWM
WAVNLIYLALAIGLNLWDTVPVRRLRARFLRKGAV
NT seq 1008 nt   +upstreamnt  +downstreamnt
gtgaggattctcggcgcggcggttgacggcgatattcccgcaaatctggtgctctcgctt
ctggggctgggcgtaccggaaatggcgcagctcatcctgcctttaagcctgttcctgggg
ctgctgatgacgctgggcaaactgtataccgaaagtgaaattacggtcatgcacgcctgt
gggttgagcaaagccgtgctggtaaaggccgccatggtactggcgttatttaccggtatc
cttgcggcggttaacgtgatgtgggccggcccctggtcgtcaaaacaccaggatgaagta
ctggcagaggcgaaagcgaaccccggtatggcggcgttggcgcagggacaattccagcag
gcgaccaacggcagctcggtgctgttcatcgaaagcgttgacggcagcgacttccacgat
gttttcctggcgcaaattcgccctaagggcaatgctcgtccttctgtggtcgtggccgat
tccggacaccttactcagttgcgcgatggttcccaggttgtcaccttaaacaaagggacg
cgttttgaaggaacggcgttgctacgcgattttcgcatcaccgacttccagaactatcag
gcaattattggccatcaggccgtggcgctggacccgaacgataccgaccagatggacatg
cgcacgttgtggaataccgacaacgatcgcgctcgcgccgagctgcactggcgtatcacg
ttagtctttaccgtatttatgatggcgctgatggtcgtgccgctcagcgtggtgaatcca
cgtcaggggcgtgtcttgtctatgttgcccgccatgctgctttatctgctgttcttcctg
atccagacctccattaaatcgaatggcggtaaaggcaaactggacccggttatctggatg
tgggcggtcaacctgatctatctggcgttggcgattggtttgaacctgtgggatacggtg
ccggtccgccgcctgcgtgcccgttttctgcgtaaaggagcggtataa

DBGET integrated database retrieval system