KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_4027
Entry
SPUL_4027         CDS       T01740                                 
Name
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: DUF2756 GvpL_GvpF Gastrin CemA DUF4834
Other DBs
NCBI-ProteinID: AET56258
LinkDB
Position
complement(4075375..4075791)
AA seq 138 aa
MKRLLLITALLPFAVLAQPINTMNNPNQPGYQIPSQQRMQTQMQTQQIQQQGMLKQQMQT
QARSQQQNLQSQLNANTQRVQQGQPGNGMLGQQTLPNTQGGMLSGSGNPDQMLNHSQPML
QQDSGTPQPDIPLKTISP
NT seq 417 nt   +upstreamnt  +downstreamnt
atgaaacgcttactacttattacggctttgttaccctttgctgtattggcccagccaatt
aacactatgaataatcctaatcagccaggttatcagatccccagccagcagcgtatgcag
acgcagatgcaaacgcagcagattcagcagcagggtatgttgaaacaacagatgcaaacg
caggcgcgcagccagcagcaaaatctacagtcgcagttgaatgccaatacgcagcgggtt
cagcagggacagccgggcaacggtatgctcggtcagcaaacgctgcccaatacgcagggc
ggaatgctcagcggcagcggaaatccggaccagatgctaaaccattcccagccaatgttg
cagcaggacagcgggactccgcagcctgacatcccgctgaaaaccatcagcccttaa

DBGET integrated database retrieval system