Selenomonas sp. oral taxon 478: ADJ74_07840 Help Entry ADJ74_07840       CDS       T04017                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism sele  Selenomonas sp. oral taxon 478 Brite KEGG Orthology (KO) [BR:sele00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sele03032]     ADJ74_07840    03036 Chromosome and associated proteins [BR:sele03036]     ADJ74_07840    03400 DNA repair and recombination proteins [BR:sele03400]     ADJ74_07840 DNA replication proteins [BR:sele03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     ADJ74_07840 Chromosome and associated proteins [BR:sele03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     ADJ74_07840 DNA repair and recombination proteins [BR:sele03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       ADJ74_07840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 NA37 Motif Other DBs NCBI-ProteinID:  AKT54348 UniProt:  A0A0K1FIH1 LinkDB All DBs Position 1:1685605..1685877 Genome browser AA seq 90 aa AA seqDB search MNKQELVANVAEQASLTKKDAEKAVNAVFETIKGALSEGDKIQLIGFGTFEVKDRAARKG RNPQTGKEIEIAASRNPVFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt ttgaacaagcaggaattggtcgcaaacgtagcagagcaggcaagtctcacgaagaaggac gcggagaaggcagtcaatgctgtttttgagacgatcaagggcgcactttccgagggtgac aagattcagctgatcggattcggcacgttcgaggtgaaggatcgtgcggcacgcaagggg cgtaacccccagacgggcaaggaaatcgagatcgcggcttcgcgtaatcctgtgttcaag gccggcaaggctctgaaggatgctgtgaactga

DBGET integrated database retrieval system