Selenomonas sp. oral taxon 478: ADJ74_07855 Help Entry ADJ74_07855       CDS       T04017                                  Name (GenBank) septum formation inhibitor MinC   KO K05589   cell division protein FtsB Organism sele  Selenomonas sp. oral taxon 478 Brite KEGG Orthology (KO) [BR:sele00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sele03036]     ADJ74_07855 Chromosome and associated proteins [BR:sele03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     ADJ74_07855 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC FtsL Motif Other DBs NCBI-ProteinID:  AKT54351 UniProt:  A0A0K1FIW1 LinkDB All DBs Position 1:1687925..1688224 Genome browser AA seq 99 aa AA seqDB search MARRKNARRPRWFVVTVLLILGYFGTMIVSQGIYLFHVRAEQRAASERLTAAQGENDRLQ AEKTHLGELPYIEKLAREELGMTGEGELPYAPGKRGNGN NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggcacggagaaagaatgcacggcggccgcgctggtttgttgtgacggttcttctgatc cttggttactttggtacgatgatcgtatcacagggaatctatctctttcacgtgcgtgcg gagcagcgtgcggcatccgagcggctgacggctgcacagggggagaatgaccgtttgcag gcggagaaaacgcatcttggggaattgccgtacattgagaaattggcgcgtgaggagctc ggcatgacgggggaaggggaacttccctatgcaccgggaaagcgtggaaacggcaactga

DBGET integrated database retrieval system