Selenomonas sp. oral taxon 136: AXE86_01690 Help Entry AXE86_01690       CDS       T04745                                  Name (GenBank) septum formation inhibitor MinC   KO K05589   cell division protein FtsB Organism selo  Selenomonas sp. oral taxon 136 Brite KEGG Orthology (KO) [BR:selo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:selo03036]     AXE86_01690 Chromosome and associated proteins [BR:selo03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     AXE86_01690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC FtsL DUF936 CcmH Meg Motif Other DBs NCBI-ProteinID:  AME02900 UniProt:  A0A0X8K992 LinkDB All DBs Position complement(368213..368512) Genome browser AA seq 99 aa AA seqDB search MARRKNARRPRWFVVTVLLILGYFGTMIVSQGIYLFHVRAEQRAASERLTAAQEENDRLQ AEKTHLGELPYIEKLAREELGMTGEGELPYAPGKRGNGN NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggcacggagaaagaatgcacggcggccgcgctggtttgttgtgacggttcttctgatc cttggttactttggtacgatgatcgtatcacagggaatctatctctttcacgtgcgtgcg gagcagcgtgcggcatccgagcggctgacggctgcacaggaggagaatgaccgtttgcag gcggagaaaacgcatcttggggaattgccgtacattgagaaattggcgcgtgaggagctc ggcatgacgggggaaggggaacttccctatgcaccgggaaagcgtggaaacggcaactga

DBGET integrated database retrieval system