Selenomonas sp. oral taxon 136: AXE86_04750 Help Entry AXE86_04750       CDS       T04745                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism selo  Selenomonas sp. oral taxon 136 Pathway selo00020   Citrate cycle (TCA cycle) selo00720   Other carbon fixation pathways selo01100   Metabolic pathways selo01110   Biosynthesis of secondary metabolites selo01120   Microbial metabolism in diverse environments selo01200   Carbon metabolism selo01210   2-Oxocarboxylic acid metabolism Module selo_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:selo00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     AXE86_04750   09102 Energy metabolism    00720 Other carbon fixation pathways     AXE86_04750 Enzymes [BR:selo01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      AXE86_04750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_7 Fer4_9 Fer4_2 Fer4_6 Fer4_21 Fer4_16 Fer4_17 Fer4_4 Fer4_8 Fer4_15 Fer4_22 Fer4_13 Fer4_3 Motif Other DBs NCBI-ProteinID:  AME03445 UniProt:  A0A120KRM7 LinkDB All DBs Position 992452..992646 Genome browser AA seq 64 aa AA seqDB search MKGELYIKEKRCKGCGICAAFCPKKVLEVSLLGKIVPVRPEDCIACGQCEMRCPDFAIFV ERRA NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgaaaggtgagctgtatatcaaggaaaagcggtgcaagggctgcggcatctgcgcggca ttctgcccgaagaaggtgctcgaggtgagtctgctcggcaagattgtgcccgtgcgcccc gaggactgcatcgcgtgcgggcagtgcgagatgcgctgtcccgattttgcgattttcgtg gagaggagggcgtag

DBGET integrated database retrieval system