Selenomonas sp. oral taxon 920: BCS37_04140 Help Entry BCS37_04140       CDS       T04818                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism selt  Selenomonas sp. oral taxon 920 Brite KEGG Orthology (KO) [BR:selt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:selt03032]     BCS37_04140    03036 Chromosome and associated proteins [BR:selt03036]     BCS37_04140    03400 DNA repair and recombination proteins [BR:selt03400]     BCS37_04140 DNA replication proteins [BR:selt03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BCS37_04140 Chromosome and associated proteins [BR:selt03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BCS37_04140 DNA repair and recombination proteins [BR:selt03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BCS37_04140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Peptidase_C80 DUF2780 Motif Other DBs NCBI-ProteinID:  AOH47682 UniProt:  A0A1B3X385 LinkDB All DBs Position 897426..897698 Genome browser AA seq 90 aa AA seqDB search MNKQELVANVAEQASLTKKDAEKAVNAVFESIKNALSEGDRIQLIGFGTFEVKGRKARKG RNPQTGKEIDIPASKTPVFKAGKALKDSVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt ttgaacaagcaggaattggtcgcaaacgtagcagagcaggcaagtctcacgaagaaggac gcggaaaaggcagtcaatgccgtttttgagtcgatcaagaacgctctttccgagggtgac agaattcagctgatcggcttcggtaccttcgaggtgaaggggcgtaaggcgcgcaagggg cgcaatccgcagacaggcaaggagatcgatattccggcttccaagacgcctgtgttcaag gctggcaaggctctgaaggactctgtgaactga

DBGET integrated database retrieval system