KEGG   Selenomonas sp. oral taxon 920: BCS37_09250
Entry
BCS37_09250       CDS       T04818                                 
Name
(GenBank) lipid A export permease/ATP-binding protein MsbA
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:7.5.2.6]
Organism
selt  Selenomonas sp. oral taxon 920
Pathway
selt02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:selt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BCS37_09250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:selt02000]
    BCS37_09250
Enzymes [BR:selt01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.6  ABC-type lipid A-core oligosaccharide transporter
     BCS37_09250
Transporters [BR:selt02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    BCS37_09250
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 RsgA_GTPase AAA_22 AAA_24 AAA AAA_30 APS_kinase AAA_29 Cytidylate_kin ATP13 HUTI_composite_bact ABC_ATPase Mannosyl_trans4 AAA_33 AAA_18 AAA_23
Other DBs
NCBI-ProteinID: AOH48615
LinkDB
Position
complement(1910336..1912060)
AA seq 574 aa
MKNYTRLLAYMRPYVNKFALAIVCIILASGANLYVPWIIKDMIDDVLADKNMALLNAICI
GIVVIFFLRGIFYFGQSYLVSYIGQKVIIDVREVMFRKFQRMPLAYYDRHQTGEIMSFVT
NDVAAIQSALVDNLIDLVTEGCILIGSLVLMFYLDWKLSLLTLVVIPMVGQAMKIFGRKI
KKSSNVIQERLAEITALLQESFSATRVVKSFVREDYEIDRFVRSNQRNFDAVMKNVQQTS
MLTPTVEFLAAIAVTFIVWFGGYEVVNGDITAGAFVAFLTYAVNLANPVKRLSRIYGNLQ
KAMAAVDRVFSVVDLEESITDKADAQVLPPVEGRVRFENVTFSYKEGRRALDGISLEAAP
GEMIAFVGPSGAGKSTIANLIPRFYEVDSGTITVDGHDIRDVTLASLRGQIGLVPQETML
FSTTIRENIRYGRLDATDAEIEEAARAANAHNFIMELEHGYDTQIGERGVSISGGQRQRI
AIARAILKDPRILILDEATSALDTESEKIVQAALDNLMVGRTSFVIAHRLSTVFNADRIY
VIDGGRIVEQGAHEELLAKGGLYQHLYDIQFRGE
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgaaaaattatacgagactgctcgcctatatgcggccgtacgtgaacaagtttgctctt
gcgatcgtgtgcatcattctcgcctcaggggcgaacctctatgtcccgtggatcatcaag
gacatgatcgacgacgtgcttgccgataagaatatggcgcttctgaacgccatctgcatc
ggcatcgtcgtcatctttttcctgcgcgggattttttactttgggcagtcctatctcgtc
tcctacatcgggcagaaggtcatcatcgacgtgcgcgaggtcatgttccgaaagttccag
cggatgccgctcgcatactatgatcgtcaccagacgggtgagatcatgagcttcgtcaca
aacgacgttgccgcgatccagtccgcgctcgtggacaaccttatcgatctcgtaacggag
ggatgtatcctcatcggctcgctcgtcctcatgttctacctcgattggaaactctctctc
ctgacgctcgtcgtcattccgatggtcggacaggcgatgaagatcttcgggcgcaagatc
aagaagtcgagcaatgtcattcaggagcgtcttgccgagattacggcgctcctgcaggag
agcttttccgcaacgcgggtcgtgaaatcctttgtgcgcgaggactatgagatcgaccgt
ttcgtccgcagcaatcagcgcaatttcgacgccgtgatgaagaatgtgcagcagacgagc
atgctcacgccgacggtcgaattccttgcggcgatcgccgtcacgttcattgtctggttc
ggcggctatgaggttgtcaacggcgacatcacggcgggtgcgttcgtcgcgttcctcacg
tacgctgtaaacctcgcaaatcccgtcaagcggctctcgcgcatctacggaaacctgcaa
aaggcgatggcggcggtcgaccgtgtattcagcgtggtcgatcttgaggagagcattacg
gacaaagcggacgcacaggtacttccgcccgtagaagggcgcgtgcggttcgagaatgtg
acgttctcctataaggaggggcggcgtgcgctcgatggcatctcgctcgaggcggcaccg
ggcgagatgattgcctttgtcggcccctcgggtgcgggaaaatccacgatcgcaaacctc
attccgcgtttctatgaggtggacagcggtacgatcaccgttgacggacatgacatccgc
gacgtgacgcttgcatctctgcgcgggcagattggccttgtgccgcaggagacgatgctg
ttctccacgaccatccgcgagaatatccgctatgggcgactcgatgcgacggatgcggag
atcgaagaggcggcgcgtgcggcgaacgcacataacttcatcatggagctcgagcacggc
tatgatacgcagatcggtgagcgcggcgtcagcatctcgggcgggcagcggcagcgcatt
gcgattgcgcgtgcgatcctcaaagatccgcgcattctcatccttgacgaggcgacctct
gcgctcgatacggagagtgagaagatcgtgcaggcggcgctcgacaatctcatggtcgga
cgcacgagctttgtcattgcacatcgtctctcgacggtatttaacgctgaccgcatctac
gtgatcgacggcggccgcatcgtggagcagggggcgcacgaggagctcctggcaaagggc
gggctctatcagcatctctatgacattcagtttcggggagagtga

DBGET integrated database retrieval system