Selenomonas sp. oral taxon 920: BCS37_09770 Help Entry BCS37_09770       CDS       T04818                                  Name (GenBank) NrdH-redoxin   KO K03676   glutaredoxin 3 Organism selt  Selenomonas sp. oral taxon 920 Brite KEGG Orthology (KO) [BR:selt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:selt03110]     BCS37_09770 Chaperones and folding catalysts [BR:selt03110]  Protein folding catalysts   Protein disulfide isomerase    BCS37_09770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 GST_N Motif Other DBs NCBI-ProteinID:  AOH48714 UniProt:  A0A1B3X6A2 LinkDB All DBs Position 2028272..2028508 Genome browser AA seq 78 aa AA seqDB search MVKVYSITVCPWCVKVKKYLKYRGIPYEEFNIEQDEAAREECRRLSGDTIVPVTTADGVD FALSYDREKLDRILGITA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggtcaaggtctactccatcacggtctgcccgtggtgcgtcaaggtcaagaagtatctc aaatatcgcggcattccctacgaggagttcaacatcgagcaggatgaggctgcgcgtgag gagtgccgccgtctctcgggcgatacgatcgtccccgtcaccacggctgacggcgtggac ttcgcactcagctatgaccgcgagaagctggacaggattctcggaatcacggcatag

DBGET integrated database retrieval system