Sideroxyarcus emersonii: MIZ01_0193 Help Entry MIZ01_0193        CDS       T08108                                  Name (GenBank) DNA-binding protein Fis   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism seme  Sideroxyarcus emersonii Brite KEGG Orthology (KO) [BR:seme00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:seme03000]     MIZ01_0193    03036 Chromosome and associated proteins [BR:seme03036]     MIZ01_0193    03400 DNA repair and recombination proteins [BR:seme03400]     MIZ01_0193 Transcription factors [BR:seme03000]  Prokaryotic type   Helix-turn-helix    Other families     MIZ01_0193 Chromosome and associated proteins [BR:seme03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     MIZ01_0193 DNA repair and recombination proteins [BR:seme03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       MIZ01_0193 SSDB OrthologParalogGFIT Motif Pfam:  HTH_8 HTH_30 Fis_N Xre-like-HTH Phage_NinH HTH_23 HTH_17 HTH_28 Motif Other DBs NCBI-ProteinID:  BCK86437 UniProt:  A0AAN2BY71 LinkDB All DBs Position 210784..211038 Genome browser AA seq 84 aa AA seqDB search MTEDCGINENDIAKHVRKAVNDYFKDLDGEEPSCGIYDMVICCAEKPLIETVLHHAGGNQ TRAAELLGINRNTLRKKMQDHRIK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaccgaagattgcggcatcaacgagaacgatatcgccaagcacgtgcgcaaggcggtg aacgactatttcaaggacctcgacggcgaagagccgtcgtgcgggatatacgacatggtg atctgttgcgcggaaaagccgctgatcgagaccgtgttgcaccatgccggcggcaaccag acgcgcgccgccgaattgctcggcatcaatcgcaacaccctgcgcaagaagatgcaggac catcgcatcaaataa

DBGET integrated database retrieval system