Sideroxyarcus emersonii: MIZ01_0346 Help Entry MIZ01_0346        CDS       T08108                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism seme  Sideroxyarcus emersonii Pathway seme01100   Metabolic pathways seme01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:seme00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MIZ01_0346    00074 Mycolic acid biosynthesis     MIZ01_0346   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MIZ01_0346 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF3979 PP-binding_2 DUF7080 DUF1216 Motif Other DBs NCBI-ProteinID:  BCK86583 UniProt:  A0AAN1X8Q6 LinkDB All DBs Position complement(365241..365489) Genome browser AA seq 82 aa AA seqDB search MSSLQTIQNMMVKQFDLKLEDLKPDATLESLGLDSLSVIEFTFNLEDELKITMPEERVEL KTLQDVVNLVDKIVAEQKGKEQ NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagttctctgcaaaccatacaaaacatgatggtcaagcaattcgacctcaagctggaa gatctcaagcccgatgccaccctggaaagcctgggcctggactcgctgtcggtgatcgaa ttcaccttcaacctcgaagacgaactgaagatcaccatgccggaggagcgcgtcgaactc aagacgctgcaggatgtggtcaacctggtggacaagatcgtcgccgagcagaagggcaaa gagcagtaa

DBGET integrated database retrieval system