Sideroxyarcus emersonii: MIZ01_1019
Help
Entry
MIZ01_1019 CDS
T08108
Name
(GenBank) NADH-quinone oxidoreductase subunit J
KO
K00339
NADH-quinone oxidoreductase subunit J [EC:
7.1.1.2
]
Organism
seme
Sideroxyarcus emersonii
Pathway
seme00190
Oxidative phosphorylation
seme01100
Metabolic pathways
Module
seme_M00144
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:
seme00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
MIZ01_1019
Enzymes [BR:
seme01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
MIZ01_1019
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Oxidored_q3
Acyl_transf_3
DUF6057
Motif
Other DBs
NCBI-ProteinID:
BCK87247
UniProt:
A0AAN2BYZ2
LinkDB
All DBs
Position
1024851..1025498
Genome browser
AA seq
215 aa
AA seq
DB search
MNLETILFYFFATVTVLAALRVITARNPLHAVLFLVLAFVSSAGIWLLLEAEFLAIALVL
VYVGAVMVLFLFVVMMLDINIERLREGFWRWLPMGLLLAALIGVQMVWVLGARDISSGMA
PVKHAADYSNTKELGRLIYTDYVYPFELAAVLLLVAMVAAIALTLRKRRDAKRQDIGKQL
KVRREDRVRIVAVPSVRKAETAQDGVAVPNGHTAD
NT seq
648 nt
NT seq
+upstream
nt +downstream
nt
atgaatcttgaaacgatattgttctattttttcgccaccgtgaccgtgctggcggccttg
cgcgtcatcactgcacgcaaccccctgcatgcggtgctgttcctggtgctggccttcgtc
agcagtgcgggcatctggctgctgctggaagcggaattcctcgccatcgccctggtgctg
gtatatgtgggcgcggtgatggtgttgttcctgtttgtggtgatgatgctggacatcaac
atcgagcgcctgcgtgaaggtttctggcgctggctgcccatgggattgttgctggccgca
ttgatcggggtgcaaatggtctgggtactgggggccagggatatctcctccggaatggcg
ccggtcaagcacgccgccgactacagcaacaccaaggagctgggccgcctgatctacacc
gattacgtctatccgttcgaattggcggcggtgctgttgctggtggcgatggtcgcagcg
atcgcgctgacgttgcgcaaacgccgcgatgccaaacggcaggacatcggcaagcagctc
aaggtcagacgggaagaccgcgtgcgcatcgttgccgttccgtccgtgcgcaaggccgaa
acggcacaggatggcgttgccgtgccgaatggccatactgcggattaa
DBGET
integrated database retrieval system