KEGG   Spirosoma endbachense: GJR95_30100
Entry
GJR95_30100       CDS       T09865                                 
Name
(GenBank) 3'-5' exonuclease
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
senf  Spirosoma endbachense
Pathway
senf03030  DNA replication
senf03430  Mismatch repair
senf03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:senf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    GJR95_30100
   03430 Mismatch repair
    GJR95_30100
   03440 Homologous recombination
    GJR95_30100
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:senf03032]
    GJR95_30100
   03400 DNA repair and recombination proteins [BR:senf03400]
    GJR95_30100
Enzymes [BR:senf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     GJR95_30100
DNA replication proteins [BR:senf03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     GJR95_30100
DNA repair and recombination proteins [BR:senf03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     GJR95_30100
SSDB
Motif
Pfam: RNase_T DEDDh_C
Other DBs
NCBI-ProteinID: QHV98998
UniProt: A0A6P1W373
LinkDB
Position
7421820..7422365
AA seq 181 aa
MYCIVDVETTGGVKGPTRLTEIAIFRHDGLQVVDSFHSLVNPECPIPPFIRHLTGISDEM
VQEAPLFADIAEQVLRITHDAVFVAHNVGFDFNFIKKELEWLGYDYFRRTLCTVRTSRKV
FPGFPSYSLGKLCNSLSIPLNNRHRAQGDAAATVRLFEMLLQHDAHGLIPRNGGASIAVH
D
NT seq 546 nt   +upstreamnt  +downstreamnt
gtgtattgtatcgttgacgtcgaaactactggaggggtaaaaggcccaacccgacttacc
gaaattgctatcttccgccatgatgggctgcaagttgtagactcgtttcattcgctggtg
aaccctgaatgtccgattccaccatttattcgtcacctgaccggtatttccgatgagatg
gttcaggaagcgccactgtttgccgacatcgccgagcaggttcttagaattacacacgat
gctgttttcgttgcccataatgtagggtttgattttaacttcatcaaaaaggagctggaa
tggctcggctatgattattttcgtcggacgctttgtactgtacggacaagccgaaaagtt
tttccaggatttccatcgtatagccttgggaaactctgtaactcgctcagcattccgctc
aacaatcgtcaccgagcgcagggtgatgcggccgctacagttcggcttttcgaaatgcta
ctccaacatgatgctcacggattgattccccgcaacggtggtgcgtcgattgcggttcat
gattaa

DBGET integrated database retrieval system