KEGG   Salmonella enterica subsp. enterica serovar Javiana: CFSAN001992_11570
Entry
CFSAN001992_11570 CDS       T02479                                 
Name
(GenBank) lipopolysaccharide ABC transporter permease
  KO
K11720  lipopolysaccharide export system permease protein
Organism
senj  Salmonella enterica subsp. enterica serovar Javiana
Pathway
senj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:senj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CFSAN001992_11570
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:senj02000]
    CFSAN001992_11570
Transporters [BR:senj02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    CFSAN001992_11570
SSDB
Motif
Pfam: LptF_LptG FtsX
Other DBs
NCBI-ProteinID: AGF82616
LinkDB
Position
complement(2338327..2339409)
AA seq 360 aa
MQPFGVLDRYIGKTIFTTIMMTLFMLVSLSGIIKFVDQLKKAGQGNYDALGAGMYTLLSV
PKDIQIFFPMAALLGALLGLGMLAQRSELVVMQASGFTRMQVALSVMKTAIPLVLLTMAI
GEWVAPQGEQMARNYRAQAMYGGSLLSTQQGLWAKDGNNFVYIERVKGDEELAGISIYAF
NDQRRLQSVRYAASAKFDPEHKVWRLSQVDESDLQNPKQITGSQTVSGTWKTNLTPDKLG
VVALDPDALSISGLHNYVKYLKSSGQDAGRYQLNMWSKIFQPLSVAVMMLMALSFIFGPL
RSVPMGVRVVTGISFGFVFYVLDQIFGPLTLVYGIPPVVGALLPSASFFLISLWLMLRKS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgcagccatttggtgtacttgaccgctatatcggtaaaaccatttttaccaccatcatg
atgacgttgttcatgctggtgtcgctctccgggatcatcaagtttgtcgatcagctgaaa
aaagcggggcagggtaactacgacgcgctgggcgcgggtatgtacaccctgctcagcgta
cctaaggatatccagatcttctttcctatggcggcgctgcttggcgcgctgctgggactg
gggatgctggcgcagcgtagcgaactggtggtgatgcaggcatcgggtttcacccgtatg
caggtggcgctgtcggtgatgaaaacggctatccccctggtgctgttaaccatggcgatc
ggcgaatgggtcgccccgcagggcgagcagatggcgcgtaactatcgtgcgcaggcgatg
tatggcggttcgctgctttccacccagcaaggtctgtgggcgaaagacgggaataacttt
gtctatattgaacgggtgaagggcgacgaggagctggccggcattagtatttacgctttc
aacgatcagcgtcgtttgcagtcggtgcgttacgccgcttcggcaaaattcgacccggag
cataaggtctggcgtttgtcgcaggtggatgagtccgatctgcaaaacccgaaacagatc
accggttcgcagacggtgagcggtacctggaaaacgaatctgacgccggataagttaggt
gtggtggcgctggacccggatgcgctttccatcagcggtctgcataactacgttaaatat
ctgaagtcgagcggacaggacgccggacgttatcagctcaatatgtggagtaaaatcttc
cagccgctctccgtggcggtgatgatgctgatggcgctgtcgtttatctttggcccactg
cgtagtgtgccgatgggcgtgcgcgtggtgacggggattagcttcggcttcgtcttttac
gttctcgaccagatttttggcccgctgacgctggtatacggcattccgccagttgtcggc
gcgctgctgccgagcgcgtctttcttcctgattagcctgtggctaatgctgcgtaagtcg
taa

DBGET integrated database retrieval system