KEGG   Secondary endosymbiont of Trabutina mannipara: TRABTM_A_01680
Entry
TRABTM_A_01680    CDS       T04494                                 
Symbol
mutH
Name
(GenBank) DNA mismatch repair protein MutH
  KO
K03573  DNA mismatch repair protein MutH
Organism
senm  Secondary endosymbiont of Trabutina mannipara
Pathway
senm03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:senm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    TRABTM_A_01680 (mutH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:senm03400]
    TRABTM_A_01680 (mutH)
DNA repair and recombination proteins [BR:senm03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Strand discrimination factor
     TRABTM_A_01680 (mutH)
SSDB
Motif
Pfam: MutH MvaI_BcnI
Other DBs
NCBI-ProteinID: SBT82019
UniProt: A0A1C3L477
LinkDB
Position
I:complement(170877..171593)
AA seq 238 aa
MNTKIKNFIPYTFPLDPPKDENALLHRANSLFGYTLGELSIYAKLEIPPNLKRNKGWIGM
LLERYLGASAKSKSEQDFASIGIELKTIPVDISRRPLETTFICVAPLTGNSGVTWETSYV
RYKLSRVLWIPIEGHRTIPLAMRRIGVPLLWSLNAKEELQLKSDWEELMDLIVLGKVENI
TAHHGDMLHLRPKASNGKALTAAIGKFGQPILTMPLGFYLRKKFTAKILERYSIYYLL
NT seq 717 nt   +upstreamnt  +downstreamnt
atgaatacaaaaataaaaaacttcattccatatacctttccgctagacccccctaaagac
gaaaatgccttgctacatagagctaattctttgtttggttatacactgggtgaattatct
atatatgctaaattagagattccccctaatcttaaacgtaataaaggatggattggcatg
ttactagaacgctatctaggcgctagcgccaaaagtaaatctgagcaagattttgcatcc
atcggcatagagctaaaaactattcctgtagatataagcagacgaccattagaaactact
tttatctgtgtagcgccgcttactggtaatagcggggtaacatgggaaactagttatgtg
cgctataagctgtctagggtactttggattcctatagaaggacatcgaacaataccgctg
gcaatgcggcgcataggtgtgccgctattgtggagtttaaacgcaaaagaagagcttcaa
ttaaaaagtgactgggaagaactaatggatttgattgttttaggtaaagtagaaaatatt
accgctcaccacggtgatatgcttcatttacgtcccaaagcttctaacgggaaagctcta
actgcagctatcggcaaatttggccaaccaatacttacgatgccgctaggtttttatcta
agaaaaaaatttactgctaaaatcctagagaggtattccatatattatctattataa

DBGET integrated database retrieval system