Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_8500
Help
Entry
SN31241_8500 CDS
T02779
Name
(GenBank) Lipopolysaccharide export system permease protein lptG
KO
K11720
lipopolysaccharide export system permease protein
Organism
senn
Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
senn02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
senn00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
SN31241_8500
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
senn02000
]
SN31241_8500
Transporters [BR:
senn02000
]
ABC transporters, prokaryotic type
ABC-2 type and other transporters
Lipopolysaccharide transporter
SN31241_8500
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LptF_LptG
FtsX
Motif
Other DBs
NCBI-ProteinID:
AGS27824
LinkDB
All DBs
Position
859899..860981
Genome browser
AA seq
360 aa
AA seq
DB search
MQPFGVLDRYIGKTIFTTIMMTLFMLVSLSGIIKFVDQLKKAGQGNYDALGAGMYTLLSV
PKDIQIFFPMAALLGALLGLGMLAQRSELVVMQASGFTRMQVALSVMKTAIPLVLLTMAI
GEWVAPQGEQMARNYRAQAMYGGSLLSTQQGLWAKDGNNFVYIERVKGDEELAGISIYAF
NDQRRLQSVRYAASAKFDPEHKVWRLSQVDESDLQNPKQITGSQTVSGTWKTNLTPDKLG
VVALDPDALSISGLHNYVKYLKSSGQDAGRYQLNMWSKIFQPLSVAVMMLMALSFIFGPL
RSVPMGVRVVTGISFGFVFYVLDQIFGPLTLVYGIPPIVGALLPSASFFLISLWLMLRKS
NT seq
1083 nt
NT seq
+upstream
nt +downstream
nt
atgcagccatttggtgtacttgaccgctatatcggtaaaaccatttttaccaccatcatg
atgacgttgttcatgctggtgtcgctctccgggatcatcaagtttgtcgatcagctgaaa
aaagcggggcagggtaactacgacgcgctgggcgcgggtatgtacaccctgctcagcgta
cctaaggatatccagatcttctttcctatggcggcgctgcttggcgcgctgctgggactg
gggatgctggcgcagcgtagcgaactggtagtgatgcaggcatcgggtttcacccgtatg
caggtggcgctgtcggtgatgaaaacggctatccctctggtgctgttaaccatggcgatc
ggcgaatgggtcgccccgcagggcgagcagatggcgcgtaactatcgtgcgcaggcgatg
tatggcggttcgctgctttccacccagcaaggtctgtgggcgaaagacgggaataacttt
gtctatattgaacgagtgaagggcgacgaggagctggccggcattagtatttacgctttc
aacgatcagcgtcgtttgcagtcggtgcgttacgccgcttcggcaaaattcgacccggag
cataaggtctggcgtttgtcgcaggtggatgagtccgatctgcaaaacccgaaacagatc
accggttcgcagacggtgagcggcacctggaaaacgaatctgacgccggataagttaggc
gtggtggcgctggacccggatgcgctttccatcagcggtctgcataactacgttaaatat
ctgaagtcgagcggacaggacgccggacgttatcagctcaatatgtggagtaaaatcttc
cagccgctctccgtggcggtgatgatgctgatggcgctgtcgtttatctttggaccgctg
cgtagtgtgccgatgggcgtgcgcgtggtgacggggattagcttcggcttcgtcttttac
gttctcgaccagatttttggcccgctgacgctggtatacggcattccgccgattgtcggc
gcgctgctgccgagcgcgtctttcttcctgattagcctgtggctaatgctgcgtaagtcg
taa
DBGET
integrated database retrieval system