Salmonella enterica subsp. enterica serovar Enteritidis EC20090193: AU37_16785
Help
Entry
AU37_16785 CDS
T03732
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
seno
Salmonella enterica subsp. enterica serovar Enteritidis EC20090193
Pathway
seno03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
seno00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
AU37_16785
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
seno03011
]
AU37_16785
Ribosome [BR:
seno03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
AU37_16785
Bacteria
AU37_16785
Archaea
AU37_16785
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Ribosomal_L5e
Motif
Other DBs
NCBI-ProteinID:
AHP75557
LinkDB
All DBs
Position
complement(3470121..3470474)
Genome browser
AA seq
117 aa
AA seq
DB search
MDKKSARIRRATRARRKLKELGATRLVVHRTPRHIYAQVIAPNGSEVLVAASTVEKAIAE
QLKYTGNKDAAAAVGKAVAERALEKGIKDVSFDRSGFQYHGRVQALADAAREAGLQF
NT seq
354 nt
NT seq
+upstream
nt +downstream
nt
atggataagaaatctgctcgtatccgtcgtgcgacccgcgcacgccgcaagctcaaagag
ctgggcgcaactcgcctggtggtacatcgtaccccgcgtcatatttacgcacaggtaatt
gcaccgaacggttctgaagttctggtagctgcttctactgtagaaaaagctatcgctgaa
caactgaagtacaccggtaacaaagacgcggctgcagctgtgggtaaagctgtcgctgaa
cgcgctctggaaaaaggcatcaaagatgtgtcctttgaccgttccgggttccaatatcat
ggtcgtgtccaggcactggcagatgctgcccgtgaagctggccttcagttctaa
DBGET
integrated database retrieval system