Seohaeicola sp. tig00000074: ACMUJL_01460 Help Entry ACMUJL_01460      CDS       T11112                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism seoh  Seohaeicola sp. tig00000074 Pathway seoh01100   Metabolic pathways seoh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:seoh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACMUJL_01460    00074 Mycolic acid biosynthesis     ACMUJL_01460   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACMUJL_01460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  XOY36722 LinkDB All DBs Position complement(267725..267988) Genome browser AA seq 87 aa AA seqDB search MSIQDKVIAIIAEQAVLEPSDVTVDSTLEDLGIDSLALVESIFAIEEAFDITIPFNANEP EKSDFDISSVAAIIAGIEKLVAERDSA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagcattcaggacaaggtcatcgccatcattgccgaacaggccgtgctggaaccttcg gatgtcacggttgacagcacgctcgaggatctgggcatcgacagcctggccctggtcgaa agcatcttcgcgatcgaggaagccttcgacatcacgatccccttcaacgccaacgaaccc gagaaatccgatttcgacatctcctcggtcgcggccatcatcgccgggatcgaaaaactg gtggccgagcgggacagcgcgtga

DBGET integrated database retrieval system